HPA015573

TLR5 antibody from Sigma-Aldrich
FLJ10052, MGC126430, MGC126431, SLEB1, TIL3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015573
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015573, RRID:AB_1858041
Product name
Anti-TLR5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015573
Antibody type
Polyclonal
Antigen
Toll-like receptor 5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LILAHHIMGAGFGFHNIKDPDQNTFAGLARSSVRH
LDLSHGFVFSLNSRVFETLKDLKVLNLAYNKINKI
ADEAFYGLDNLQVLNLSYNLLGELYSSNFYGLPKV
AYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALT
TIHFIPS
Storage
-20C
Provider Type Product Number
- No reagents -