Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00079019-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00079019-M01, RRID:AB_426067
- Product name
- C22orf18 monoclonal antibody (M01), clone 4C12-2C8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant C22orf18.
- Antigen sequence
MSVLRPLDKLPGLNTATILLVGTEDALLQQLADSM
LKEDCASELKVHLAKSLPLPSSVNRPRIDLIVFVV
NLHSKYSLQNTEESLRHVDASFFLGKVCFLATGAG
RESHCSIHRHTVVKLAHTYQSPLLYCDLEVEGFRA
TMAQRLVRVLQICAGHVPGVSALNLLSLLRSSEGP
SLEDL- Isotype
- IgG
- Antibody clone number
- 4C12-2C8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- C22orf18 monoclonal antibody (M01), clone 4C12-2C8 Western Blot analysis of C22orf18 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CENPM expression in transfected 293T cell line by C22orf18 monoclonal antibody (M01), clone 4C12-2C8.Lane 1: CENPM transfected lysate (Predicted MW: 19.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged C22orf18 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to MGC861 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of CENPM transfected lysate using anti-CENPM monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CENPM MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol