H00145173-B01

B3GLCT antibody from Abnova Corporation
B3GALTL, B3Glc-T, B3GTL

Antibody data

Product number
H00145173-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00145173-B01, RRID:AB_1204926
Product name
RP11-367C11.1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00145173-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human RP11-367C11.1 protein.
Antigen sequence
MRPPACWWLLAPPALLALLTCSLAFGLASEDTKKE
VKQSQDLEKSGISRKNDIDLKGIVFVIQSQSNSFH
AKRAEQLKKSILKQAADLTQELPSVLLLHQLAKQE
GAWTILPLLPHFSVTYSRNSSWIFFCEEETRIQIP
KLLETLRRYDPSKEWFLGKALHDEEATIIHHYAFS
ENPTVFKYPDFAAGWALSIPLVNKLTKRLKSESLK
SDFTIDLKHEIALYIWDKGGGPPLTPVPEFCTNDV
DFYCATTFHSFLPLCRKPVKKKDIFVAVKTCKKFH
GDRIPIVKQTWESQASLIEYYSDYTENSIPTVDLG
IPNTDRGHCGKTFAILERFLNRSQDKTAWLVIVDD
DTLISISRLQHLLSCYDSGKPVFLGERYGYGLGTG
GYSYITGGGGMVFSREAVRRLLASKCRCYSNDAPD
DMVLGMCFSGLGIPVTHSPLFHQARPVDYPKDYLS
HQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQET
QKGFREEL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -