HPA017664

B3GLCT antibody from Sigma-Aldrich
B3GALTL, B3Glc-T, B3GTL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017664
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017664, RRID:AB_1845241
Product name
Anti-B3GALTL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017664
Antibody type
Polyclonal
Antigen
Beta-1,3-glucosyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPVPEFCTNDVDFYCATTFHSFLPLCRKPVKKKDI
FVAVKTCKKFHGDRIPIVKQTWESQASLIEYYSDY
TENSIPTVDLGIPNTDRGHCGKTFAILERFLNRSQ
DKTAWLVIV
Storage
-20C
Provider Type Product Number
- No reagents -