Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA039936 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA039936, RRID:AB_10795239
- Product name
- Anti-MAP3K12
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GAKGEPPPPVGPGEGVGLLGTGREGTSGRGGSRAG
SQHLTPAALLYRAAVTRSQKRGISSEEEEGEVDSE
VELTSSQRWPQSLNMRQSLSTFSSENPSDGEEGTA
SEPSPSGTPEVGSTNTDERPDERSDDMCSQGSEIP
LDP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references ZPK/DLK and MKK4 form the critical gateway to axotomy-induced motoneuron death in neonates.
Itoh T, Horiuchi M, Ikeda RH Jr, Xu J, Bannerman P, Pleasure D, Penninger JM, Tournier C, Itoh A
The Journal of neuroscience : the official journal of the Society for Neuroscience 2014 Aug 6;34(32):10729-42
The Journal of neuroscience : the official journal of the Society for Neuroscience 2014 Aug 6;34(32):10729-42
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human gallbladder shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN