HPA014025

P2RX2 antibody from Sigma-Aldrich
DFNA41, P2X2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014025
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014025, RRID:AB_1854877
Product name
Anti-P2RX2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014025
Antibody type
Polyclonal
Antigen
P2X purinoceptor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CVPYYQGPSKTCEVFGWCPVEDGASVSQFLGTMAP
NFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTF
HEASDLYCPIFKLGFIVEKAGESFTELAHKGGVIG
VIINWDCDLDLPASECNP
Storage
-20C
Provider Type Product Number
- No reagents -