SAB2100526

CYP4F12 antibody from MilliporeSigma / Merck KGaA
No application information provided.

Antibody data

Product number
SAB2100526
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-CYP4F12 (ab2) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2100526
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_076433.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPR
NCIGQAFAMAEMKVV
Storage
-20C