Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00083452-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00083452-M01, RRID:AB_606900
- Product name
- RAB33B monoclonal antibody (M01), clone 6F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAB33B.
- Antigen sequence
TNMASFHSLPSWIEECKQHLLANDIPRILVGNKCD
LRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDND
HVEAIFMTLAHKLKSHKPLM- Isotype
- IgG
- Antibody clone number
- 6F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Fc gamma receptor IIb participates in maternal IgG trafficking of human placental endothelial cells.
Ishikawa T, Takizawa T, Iwaki J, Mishima T, Ui-Tei K, Takeshita T, Matsubara S, Takizawa T
International journal of molecular medicine 2015 May;35(5):1273-89
International journal of molecular medicine 2015 May;35(5):1273-89
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RAB33B monoclonal antibody (M01), clone 6F4. Western Blot analysis of RAB33B expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RAB33B is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol