WH0092737M3

DNER antibody from Sigma-Aldrich
bet, UNQ26
ELISA
Recommended by provider

Antibody data

Product number
WH0092737M3
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0092737M3, RRID:AB_1841334
Product name
Monoclonal Anti-DNER antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0092737M3
Antibody type
Monoclonal
Antigen
DNER (NP_620711, a.a. 368-477) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human, Mouse, Rat
Antigen sequence
NEKQDGSNFTCVCLPGYTGELCQSKIDYCILDPCR
NGATCISSLSGFTCQCPEGYFGSACEEKVDLCASS
PCQNNGTCYVDGVHFTCNCSPGFTGPTCAQLIDFC
ALSP* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -