HPA017320

DNER antibody from Sigma-Aldrich
bet, UNQ26
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017320
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017320, RRID:AB_1847808
Product name
Anti-DNER antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017320
Antibody type
Polyclonal
Antigen
Delta and Notch-like epidermal growth factor-related receptor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLI
LLWKVTATGFQQCSLIDGRSVTPLQASGGLVLLEE
MLALGNNHFIGFVNDSVTKSIVALRLTLVVKVSTC
VPGESHANDLECSGKGKCTTKP
Storage
-20C
Provider Type Product Number
- No reagents -