HPA006298

NFKBIL1 antibody from Sigma-Aldrich
IKBL, NFKBIL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006298
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006298, RRID:AB_1079480
Product name
Anti-NFKBIL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006298
Antibody type
Polyclonal
Antigen
Nuclear factor of kappa-light polypeptide gene enhancer in B-cells inhibitor-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RFRRYLSAGRLVRAQALLQRHPGLDVDAGQPPPLH
RACARHDAPALCLLLRLGADPAHQDRHGDTALHAA
ARQGPDAYTDFFLPLLSRCPSAMGIKNKDGETPGQ
ILGWGPPWDSAEEEEEDDASKEREWRQKLQGE
Storage
-20C
Provider Type Product Number
- No reagents -