Antibody data

Product number
H00056141-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00056141-M08, RRID:AB_1137350
Product name
PCDHA7 monoclonal antibody (M08), clone 1C7
Provider product page
Abnova Corporation - H00056141-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PCDHA7.
Antigen sequence
AESRPLDSRFPLEGASDADIGENALLTYRLSPNEY
FFLDVPTSNQQVKPLGLVLRKLLDREETPELHLLL
TATDGGKPELTGTVQLLITVLDNNDNAPV
Isotype
IgG
Antibody clone number
1C7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -