HPA012381

HEPACAM2 antibody from Sigma-Aldrich
FLJ38683
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012381
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012381, RRID:AB_1853037
Product name
Anti-HEPACAM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012381
Antibody type
Polyclonal
Antigen
Ig-like domain-containing protein UNQ305/PRO346 precursor.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPVHYGFHTPASDIQIIWLFERPHTMPKYLLGSVN
KSVVPDLEYQHKFTMMPPNASLLINPLQFPDEGNY
IVKVNIQGNGTLSASQKIQVTVDDPVTKPVVQIHP
PSGA
Storage
-20C
Provider Type Product Number
- No reagents -