H00026578-B02P

OSTF1 antibody from Abnova Corporation
bA235O14.1, OSF, SH3P2

Antibody data

Product number
H00026578-B02P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00026578-B02P, RRID:AB_1578321
Product name
OSTF1 purified MaxPab mouse polyclonal antibody (B02P)
Provider product page
Abnova Corporation - H00026578-B02P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human OSTF1 protein.
Antigen sequence
MSKPPPKPVKPGEGGQVKVFRALYTFEPRTPDELY
FEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVA
EQAESIDNPLHEAAKRGNLSWLRECLDNRVGVNGL
DKAGSTALYWACHGGHKDIVEMLFTQPNIELNQQN
KLGDTALHAAAWKGYADIVQLFLAKGARTDLRNIE
KKLAFDMATNAACASLLKKKQGTDAVRTLSNAEDY
LDDEDSD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -