SAB1400492

OSTF1 antibody from Sigma-Aldrich
bA235O14.1, OSF, SH3P2
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
SAB1400492
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400492, RRID:AB_1854833
Product name
Anti-OSTF1 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400492
Antibody type
Polyclonal
Antigen
OSTF1 (AAH07459.1, a.a. 1-217) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MSKPPPKPVKPGEGGQVKVFRALYTFEPRTPDELY
FEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVA
EQAESIDNPLHEAAKRGNLSWLRECLDNRVGVNGL
DKAGSTALYWACHGGHKDIVEMLFTQPNIELNQQN
KLGDTALHAAAWKGYADIVQLFLAKGARTDLRNIE
KKLAFDMATNAACASLLKKKQGTDAVRTLSNAEDY
LDDEDSD (without GST)
Storage
-20C
Provider Type Product Number
- No reagents -