HPA014270

IGFL1 antibody from Sigma-Aldrich
UNQ644
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014270
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014270, RRID:AB_1851502
Product name
Anti-IGFL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014270
Antibody type
Polyclonal
Antigen
Insulin growth factor-like family member 1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLAR
TQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSART
SD
Storage
-20C
Provider Type Product Number
- No reagents -