HPA017976

PCDH18 antibody from Sigma-Aldrich
KIAA1562, PCDH68L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017976
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017976, RRID:AB_1855045
Product name
Anti-PCDH18 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017976
Antibody type
Polyclonal
Antigen
Protocadherin-18 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IHKGDITLVPTINGTLPIRSHHRSSPSSSPTLERG
QMGSRQSHNSHQSLNSLVTISSNHVPENFSLELTH
ATPAVEQVSQLLSMLHQGQYQPRPSFRGNKYSRSY
R
Storage
-20C
Provider Type Product Number
- No reagents -