Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA017976 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA017976, RRID:AB_1855045
- Product name
- Anti-PCDH18
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IHKGDITLVPTINGTLPIRSHHRSSPSSSPTLERG
QMGSRQSHNSHQSLNSLVTISSNHVPENFSLELTH
ATPAVEQVSQLLSMLHQGQYQPRPSFRGNKYSRSY
R- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Protocadherin-18 is a novel differentiation marker and an inhibitory signaling receptor for CD8+ effector memory T cells.
Vazquez-Cintron EJ, Monu NR, Burns JC, Blum R, Chen G, Lopez P, Ma J, Radoja S, Frey AB
PloS one 2012;7(5):e36101
PloS one 2012;7(5):e36101
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
- Sample type
- HUMAN