ABIN310880
antibody from antibodies-online
Targeting: LAPTM4A
HUMORF13, KIAA0108, LAPTM4, MBNT, Mtrp
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310880 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Lysosomal Protein Transmembrane 4 alpha (LAPTM4A) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LAPTM4A antibody: synthetic peptide directed towards the middle region of human LAPTM4A
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLA
LDSSC LLFIVLVFFA- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
Fugu ESTs: new resources for transcription analysis and genome annotation.
Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A
Genome research 2003 Oct;13(10):2265-70
Genome research 2003 Oct;13(10):2265-70
Fugu ESTs: new resources for transcription analysis and genome annotation.
Clark MS, Edwards YJ, Peterson D, Clifton SW, Thompson AJ, Sasaki M, Suzuki Y, Kikuchi K, Watabe S, Kawakami K, Sugano S, Elgar G, Johnson SL
Genome research 2003 Dec;13(12):2747-53
Genome research 2003 Dec;13(12):2747-53
No comments: Submit comment
No validations: Submit validation data