H00009721-B01

GPRIN2 antibody from Abnova Corporation
KIAA0514, MGC15171

Antibody data

Product number
H00009721-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009721-B01, RRID:AB_1204568
Product name
KIAA0514 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00009721-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human KIAA0514 protein.
Antigen sequence
MSSSHPEPGPWAPLSPRLQPLSQSSSSLLGEGREQ
RPELHKTASSTMWQAQLGEASTRPQAPEEEGNPPE
SMKPARASGPKARPSAGGHWRSSTVGNVSTMGGGD
LCRLRAPSAAAMQRSHSDLVRSTQMRGHSGARKAS
LSCSALGSSPVHRAQLQPGGTSGQGGQAPAGLERD
LAPEDETSNSAWMLGASQLSVPPLDLGDTTAHSSS
AQAEPKAAEQLATTTCHALPPAALLCGMREMREVG
AGGCCHALPATGILAFPKLVASVSESGLQAQHGVK
IHCRLSGGLPGHSHCCAHLWGPAGLVPEPGSRTKD
VWTMTSANDLAPAEASPLSAQDAGVQAAPVAACKA
VATSPSLEAPAALHVFPEVTLGSSLEEAPSPVRDV
RWDAEGMTWEVYGAAVDPEVLGVAIQKHLEMQFEQ
LQRAPASEDSLSVEGRRGPLRAVMQSLRRPSCCGC
SGAAPE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -