Antibody data

Product number
ABIN503337
Provider
antibodies-online
Product name
anti-Tribbles Homolog 1 (Drosophila) (TRIB1) antibody
Provider product page
antibodies-online - ABIN503337
Antibody type
Polyclonal
Antigen
The immunogen for anti-TRIB1 antibody: synthetic peptide directed towards the middle region of human TRIB1
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
Host
Rabbit
Antigen sequence
TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYV
SPEIL NTTGTYSGKA
Vial size
50 µg
Provider Type Product Number
- No reagents -