H00055340-M14A

GIMAP5 antibody from Abnova Corporation
HIMAP3, IAN4L1, IAN5

Antibody data

Product number
H00055340-M14A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055340-M14A, RRID:AB_1575191
Product name
GIMAP5 monoclonal antibody (M14A), clone 3F11
Provider product page
Abnova Corporation - H00055340-M14A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant GIMAP5.
Antigen sequence
MGGFQRGKYGTMAEGRSEDNLSATPPALRIILVGK
TGCGKSATGNSILGQPAFESKLRAQSVTRTCQVKT
GTWNGRKVLVVDTPSIFESQADTQELYKNIGDCYL
LSAPGPHVLLLVIQLGRFTAQDTVAIRKVKEVFGT
GAMRHVVILFTHKEDLGGQALDDYVANTDNCSLKD
LVRECERRYCAFNNWGSVEEQRQQQAELLAVIERL
GREREGSFHSNDLFLDAQLLQRTGAGACQEDYRQY
QAKVEWQVEKHKQELRENESNWAYKALLRVKHLML
LHYEIFVFLLLCSILFFIIFLFIFHYI
Isotype
IgM
Antibody clone number
3F11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -