HPA015102

GIMAP5 antibody from Sigma-Aldrich
HIMAP3, IAN4L1, IAN5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015102
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015102, RRID:AB_1849674
Product name
Anti-GIMAP5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015102
Antibody type
Polyclonal
Antigen
GTPase IMAP family member 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
THKEDLGGQALDDYVANTDNCSLKDLVRECERRYC
AFNNWGSVEEQRQQQAELLAVIERLGREREGSFHS
NDLFLDAQLLQRTGAGACQEDYRQYQAKVEWQVEK
Storage
-20C
Provider Type Product Number
- No reagents -