HPA012542

PTPN1 antibody from Sigma-Aldrich
PTP1B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012542
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012542, RRID:AB_1855915
Product name
Anti-PTPN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012542
Antibody type
Polyclonal
Antigen
Tyrosine-protein phosphatase non-receptor type 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPP
PEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEE
TQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRS
RVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYW
Storage
-20C
Provider Type Product Number
- No reagents -