HPA028378

RNF207 antibody from Sigma-Aldrich
C1orf188, FLJ32096, FLJ46380
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028378
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028378, RRID:AB_10601157
Product name
Anti-RNF207 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028378
Antibody type
Polyclonal
Antigen
ring finger protein 207 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVDEQSESLQNTHDDSRNNAASARNNPGSVPEKRE
KTSEPKGNSWAPNGLSEEPLLKNMDHHRSKQKNGG
DVPTWREHP
Storage
-20C
Provider Type Product Number
- No reagents -