HPA017226

MAN2A2 antibody from Sigma-Aldrich
HsT19662, MANA2X
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017226
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017226, RRID:AB_1853514
Product name
Anti-MAN2A2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017226
Antibody type
Polyclonal
Antigen
mannosidase, alpha, class 2A, member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HHDAITGTAKEAVVVDYGVRLLRSLVNLKQVIIHA
AHYLVLGDKETYHFDPEAPFLQVDDTRLSHDALPE
RTVIQLDSSPRFVVLFNPLEQERFSMVSLLVNSPR
VRVLSEEGQPLAVQISAHWSSATEAVPDVYQVSVP
Storage
-20C
Provider Type Product Number
- No reagents -