HPA012157

AJAP1 antibody from Sigma-Aldrich
MOT8, SHREW-1, SHREW1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012157
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012157, RRID:AB_2289413
Product name
Anti-AJAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012157
Antibody type
Polyclonal
Antigen
Adherens junction-associated protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGNTRRNSHQRKTNQQEESCQNLTDFPSARVPSSL
DIFTAYNETLQCSHECVRASVPVYTDETLHSTTGE
YKSTFNGNRPSSSDRHLIPVAFVSEKWFEISC
Storage
-20C
Provider Type Product Number
- No reagents -