Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA012157 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-AJAP1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SGNTRRNSHQRKTNQQEESCQNLTDFPSARVPSSL
DIFTAYNETLQCSHECVRASVPVYTDETLHSTTGE
YKSTFNGNRPSSSDRHLIPVAFVSEKWFEISC- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Complex formation of APP with GABAB receptors links axonal trafficking to amyloidogenic processing
Molecular Diversity of Midbrain Development in Mouse, Human, and Stem Cells
Alternative exon usage creates novel transcript variants of tumor suppressor SHREW-1 gene with differential tissue expression profile.
Dinamarca M, Raveh A, Schneider A, Fritzius T, Früh S, Rem P, Stawarski M, Lalanne T, Turecek R, Choo M, Besseyrias V, Bildl W, Bentrop D, Staufenbiel M, Gassmann M, Fakler B, Schwenk J, Bettler B
Nature Communications 2019;10(1)
Nature Communications 2019;10(1)
Molecular Diversity of Midbrain Development in Mouse, Human, and Stem Cells
La Manno G, Gyllborg D, Codeluppi S, Nishimura K, Salto C, Zeisel A, Borm L, Stott S, Toledo E, Villaescusa J, Lönnerberg P, Ryge J, Barker R, Arenas E, Linnarsson S
Cell 2016;167(2):566-580.e19
Cell 2016;167(2):566-580.e19
Alternative exon usage creates novel transcript variants of tumor suppressor SHREW-1 gene with differential tissue expression profile.
Klemmt PA, Resch E, Smyrek I, Engels K, Stelzer EH, Starzinski-Powitz A
Biology open 2016 Nov 15;5(11):1607-1619
Biology open 2016 Nov 15;5(11):1607-1619
No comments: Submit comment
No validations: Submit validation data