Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405861 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Isoprenylcysteine Carboxyl Methyltransferase (ICMT) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ICMT antibody: synthetic peptide directed towards the middle region of human ICMT
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
GSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGW
FYWSI GTQVMLCNPI- Vial size
- 50 µg
Submitted references Inhibition of ICMT induces endothelial cell apoptosis through GRP94.
Is there a preferred gestational age threshold of viability?: a survey of maternal-fetal medicine providers.
Lu Q, Harrington EO, Newton J, Jankowich M, Rounds S
American journal of respiratory cell and molecular biology 2007 Jul;37(1):20-30
American journal of respiratory cell and molecular biology 2007 Jul;37(1):20-30
Is there a preferred gestational age threshold of viability?: a survey of maternal-fetal medicine providers.
Nuthalapaty F, Lu G, Ramin S, Nuthalapaty E, Ramin KD, Ramsey PS
The journal of maternal-fetal & neonatal medicine : the official journal of the European Association of Perinatal Medicine, the Federation of Asia and Oceania Perinatal Societies, the International Society of Perinatal Obstetricians 2007 Apr;20(4):293-7
The journal of maternal-fetal & neonatal medicine : the official journal of the European Association of Perinatal Medicine, the Federation of Asia and Oceania Perinatal Societies, the International Society of Perinatal Obstetricians 2007 Apr;20(4):293-7
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting