Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007171-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007171-M01, RRID:AB_425723
- Product name
- TPM4 monoclonal antibody (M01), clone 4E4-1D2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant TPM4.
- Antigen sequence
MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQREL
DGERERREKAEGDVAALNRRIQLVEEELDRAQERL
ATALQKLEEAEKAADESERGMKVIENRAMKDEEKM
EIQEMQLKEAKHIAEEADRKYEEVARKLVILEGEL
ERAEERAEVSELKCGDLEEELKNVTNNLKSLEAAS
EKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTV
AKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNEL
NCI- Isotype
- IgG
- Antibody clone number
- 4E4-1D2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references LRRK2 guides the actin cytoskeleton at growth cones together with ARHGEF7 and Tropomyosin 4.
Häbig K, Gellhaar S, Heim B, Djuric V, Giesert F, Wurst W, Walter C, Hentrich T, Riess O, Bonin M
Biochimica et biophysica acta 2013 Dec;1832(12):2352-67
Biochimica et biophysica acta 2013 Dec;1832(12):2352-67
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TPM4 monoclonal antibody (M01), clone 4E4-1D2 Western Blot analysis of TPM4 expression in Hela ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TPM4 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to TPM4 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to TPM4 on formalin-fixed paraffin-embedded human transitional cell carcinoma tissue. [antibody concentration 2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol