H00004123-M01A

MAN2C1 antibody from Abnova Corporation
MANA, MANA1
No application information provided.

Antibody data

Product number
H00004123-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004123-M01A, RRID:AB_1237773
Product name
MAN2C1 monoclonal antibody (M01A), clone 1G12
Provider product page
Abnova Corporation - H00004123-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MAN2C1.
Antigen sequence
HCHIDTAWLWPFKETVRKCARSWVTALQLMERNPE
FIFACSQAQQLEWVKSRYPGLYSRIQEFACRGQFV
PVGGTWVEMDGNLPSGEAMVRQFLQGQNFFLQEFG
KMCSE
Isotype
IgM
Antibody clone number
1G12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -