HPA012315

HLA-DQA1 antibody from Sigma-Aldrich
CELIAC1, HLA-DQA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012315
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012315, RRID:AB_1853930
Product name
Anti-HLA-DQA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012315
Antibody type
Polyclonal
Antigen
HLA class II histocompatibility antigen, DQ(5) alpha chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLE
RKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNI
MIKRYNSTAATNEVPEVTVFSKSPVTLGQPNTLI
Storage
-20C
Provider Type Product Number
- No reagents -