HPA012548

C6orf89 antibody from Sigma-Aldrich
BRAP, FLJ25357
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012548
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012548, RRID:AB_1845748
Product name
Anti-C6orf89 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012548
Antibody type
Polyclonal
Antigen
Uncharacterized protein C6orf89 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QPFSPLAPEPVLSGAHTWRSLIHHIRLMSLPIAKK
YMSENKGVPLHGGDEDRPFPDFDPWWTNDCEQNES
EPIPANCTGCAQKHLKVMLLEDAPRKFERLHPLVI
KTGKPLLEEEIQHFLCQYPEATEGFSEGFFAKWWR
CFPERWF
Storage
-20C
Provider Type Product Number
- No reagents -