HPA012548

C6orf89 antibody from Atlas Antibodies
BRAP, FLJ25357
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012548
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012548, RRID:AB_1845748
Product name
Anti-C6orf89
Provider product page
Atlas Antibodies - HPA012548
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QPFSPLAPEPVLSGAHTWRSLIHHIRLMSLPIAKK
YMSENKGVPLHGGDEDRPFPDFDPWWTNDCEQNES
EPIPANCTGCAQKHLKVMLLEDAPRKFERLHPLVI
KTGKPLLEEEIQHFLCQYPEATEGFSEGFFAKWWR
CFPERWF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -