Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004218-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004218-M02, RRID:AB_519014
- Product name
- RAB8A monoclonal antibody (M02), clone 3G1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAB8A.
- Antigen sequence
EHASADVEKMILGNKCDVNDKRQVSKERGEKLALD
YGIKFMETSAKANINVENAFFTLARDIKAKMDKKL
EGNSPQGSNQGVKITPDQQKRSSFFRCVLL- Isotype
- IgG
- Antibody clone number
- 3G1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Critical role of Rab11a-mediated recycling endosomes in the assembly of type I parainfluenza viruses.
Stone R, Hayashi T, Bajimaya S, Hodges E, Takimoto T
Virology 2016 Jan;487:11-8
Virology 2016 Jan;487:11-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RAB8A monoclonal antibody (M02), clone 3G1 Western Blot analysis of RAB8A expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RAB8A is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol