HPA014365

CDH18 antibody from Sigma-Aldrich
CDH14, EY-CADHERIN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014365
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014365, RRID:AB_1845898
Product name
Anti-CDH18 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014365
Antibody type
Polyclonal
Antigen
Cadherin-18 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DNPPRFPQKHYQLYVPESAQVGSAVGKIKANDADT
GSNADMTYSIINGDGMGIFSISTDKETREGILSLK
KPLNYEKKKSYTLNIEGANTHLDFRFSHLGPFKDA
TMLKIIVGDVDEPPLFSMPSYLMEVYENAKIGTVV
GTVLAQDPD
Storage
-20C
Provider Type Product Number
- No reagents -