HPA014365

CDH18 antibody from MilliporeSigma / Merck KGaA
CDH14, EY-CADHERIN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014365
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-CDH18 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA014365
Antibody type
Polyclonal
Antigen
Cadherin-18 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DNPPRFPQKHYQLYVPESAQVGSAVGKIKANDADT
GSNADMTYSIINGDGMGIFSISTDKETREGILSLK
KPLNYEKKKSYTLNIEGANTHLDFRFSHLGPFKDA
TMLKIIVGDVDEPPLFSMPSYLMEVYENAKIGTVV
GTVLAQDPD
Storage
-20C