Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003229-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003229-M01, RRID:AB_489812
- Product name
- HOXC13 monoclonal antibody (M01), clone 10D4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HOXC13.
- Antigen sequence
CRLSHNVNLQQKPCAYHPGDKYPEPSGALPGDDLS
SRAKEFAFYPSFASSYQAMPGYLDVSVVPGISGHP
EPRHDALIPVEGYQHWALSNGWDSQVYCSK- Isotype
- IgG
- Antibody clone number
- 10D4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Palmitoylation regulates epidermal homeostasis and hair follicle differentiation.
Dlx3 is a crucial regulator of hair follicle differentiation and cycling.
Mill P, Lee AW, Fukata Y, Tsutsumi R, Fukata M, Keighren M, Porter RM, McKie L, Smyth I, Jackson IJ
PLoS genetics 2009 Nov;5(11):e1000748
PLoS genetics 2009 Nov;5(11):e1000748
Dlx3 is a crucial regulator of hair follicle differentiation and cycling.
Hwang J, Mehrani T, Millar SE, Morasso MI
Development (Cambridge, England) 2008 Sep;135(18):3149-59
Development (Cambridge, England) 2008 Sep;135(18):3149-59
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HOXC13 monoclonal antibody (M01), clone 10D4 Western Blot analysis of HOXC13 expression in A-549 ( Cat # L025V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HOXC13 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol