Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405819 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Oncostatin M Receptor (OSMR) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-OSMR antibody: synthetic peptide directed towards the middle region of human OSMR
- Description
- Affinity Purified
- Reactivity
- Human, Canine
- Host
- Rabbit
- Antigen sequence
LLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWK
DYSTE SQPGFIQGYH- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Oncostatin M receptor-beta mutations underlie familial primary localized cutaneous amyloidosis.
Arita K, South AP, Hans-Filho G, Sakuma TH, Lai-Cheong J, Clements S, Odashiro M, Odashiro DN, Hans-Neto G, Hans NR, Holder MV, Bhogal BS, Hartshorne ST, Akiyama M, Shimizu H, McGrath JA
American journal of human genetics 2008 Jan;82(1):73-80
American journal of human genetics 2008 Jan;82(1):73-80
No comments: Submit comment
No validations: Submit validation data