HPA017278

OSMR antibody from Sigma-Aldrich
OSMRB, OSMRbeta
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017278
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017278, RRID:AB_1854818
Product name
Anti-OSMR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017278
Antibody type
Polyclonal
Antigen
Oncostatin-M specific receptor subunit beta precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IKETCYPDIPDPYKSSILSLIKFKENPHLIIMNVS
DCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKP
NYLYLLPTEKNHSGPGPCICFENLTYNQAASDSGS
CGHVPVSPKAPSMLGLMTSPE
Storage
-20C
Provider Type Product Number
- No reagents -