HPA017278

OSMR antibody from Atlas Antibodies
OSMRB
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA017278
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017278, RRID:AB_1235053
Product name
Anti-OSMR
Provider product page
Atlas Antibodies - HPA017278
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IKETCYPDIPDPYKSSILSLIKFKENPHLIIMNVS
DCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKP
NYLYLLPTEKNHSGPGPCICFENLTYNQAASDSGS
CGHVPVSPKAPSMLGLMTSPE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -