Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003224-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003224-M01, RRID:AB_606406
- Product name
- HOXC8 monoclonal antibody (M01), clone 5G1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HOXC8.
- Antigen sequence
PGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSC
HGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKS
SANTNSSEGQGHLNQNSSPS- Isotype
- IgG
- Antibody clone number
- 5G1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Ratio of miR-196s to HOXC8 messenger RNA correlates with breast cancer cell migration and metastasis.
Li Y, Zhang M, Chen H, Dong Z, Ganapathy V, Thangaraju M, Huang S
Cancer research 2010 Oct 15;70(20):7894-904
Cancer research 2010 Oct 15;70(20):7894-904
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HOXC8 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol