Antibody data

Product number
ABIN504367
Provider
antibodies-online
Product name
anti-Homeobox C8 (HOXC8) antibody
Provider product page
antibodies-online - ABIN504367
Antibody type
Polyclonal
Antigen
The immunogen for anti-HOXC8 antibody: synthetic peptide directed towards the middle region of human HOXC8
Reactivity
Human, Mouse, Rat
Host
Rabbit
Antigen sequence
SVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPW
MRPHA PGRRSGRQTY
Vial size
50 µg
Provider Type Product Number
- No reagents -