H00009754-B01P

STARD8 antibody from Abnova Corporation
ARHGAP38, KIAA0189

Antibody data

Product number
H00009754-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009754-B01P, RRID:AB_1581021
Product name
STARD8 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00009754-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human STARD8 protein.
Antigen sequence
MTLNNCASMKLEVHFQSKQNEDSEEEEQCTISSHW
AFQQESKCWSPMGSSDLLAPPSPGLPATSSCESVL
TELSATSLPVITVSLPPEPADLPLPGRAPSSSDRP
LLSPTQGQEGPQDKAKKRHRNRSFLKHLESLRRKE
KSGSQQAEPKHSPATSEKVSKASSFRSCRGFLSAG
FYRAKNWAATSAGGSGANTRKAWEAWPVASFRHPQ
WTHRGDCLVHVPGDHKPGTFPRSLSIESLCPEDGH
RLADWQPGRRWGCEGRRGSCGSTGSHASTYDNLPE
LYPAEPVMVGAEAEDEDDEESGGSYAHLDDILQHV
WGLQQRVELWSRAMYPDLGPGDEEEEEATSSVEIA
TVEVKCQAEALSQMEVPAHGESPAWAQAEVQPAVL
APAQAPAEAEPVAQEEAEAPAPAPAPAPAQDSEQE
AHSGGEPTFASSLSVEEGHSISDTVASSSELDSSG
NSMNEAEAAGPLAGLQASMPRERRDSGVGASLTRP
CRKLRWHSFQNSHRPSLNSESLEINRQFAGQINLL
HKGSLLRLTAFMEKYTVPHKQGWVWSMPKFMRRNK
TPDYRGQHVFGVPPLIHVQRTGQPLPQSIQQAMRY
LRSQCLDQVGIFRKSGVKSRIQNLRQMNETSPDNV
CYEGQSAYDVADLLKQYFRDLPEPIFTSKLTTTFL
QIYQLLPKDQWLAAAQAATLLLPDENREVLQTLLY
FLSDIASAEENQMTAGNLAVCLAPSIFHLNVSKKD
SPSPRIKSKRSLIGRPGPRDLSDNMAATQGLSHMI
SDCKKLFQVPQDMVLQLCSSYSAAELSPPGPALAE
LRQAQAAGVSLSLYMEENIQDLLRDAAERFKGWMS
VPGPQHTELACRKAPDGHPLRLWKASTEVAAPPAV
VLHRVLRERALWDEDLLRAQVLEALMPGVELYHYV
TDSMAPHPCRDFVVLRMWRSDLPRGGCLLVSQSLD
PEQPVPESGVRALMLTSQYLMEPCGLGRSRLTHIC
RADLRGRSPDWYNKVFGHLCAMEVAKIRDSFPTLQ
AAGPETKL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -