H00151449-M06

GDF7 antibody from Abnova Corporation
BMP12
No application information provided.

Antibody data

Product number
H00151449-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00151449-M06, RRID:AB_1575157
Product name
GDF7 monoclonal antibody (M06), clone 2G12
Provider product page
Abnova Corporation - H00151449-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GDF7.
Antigen sequence
VGQRWEAFDVADAMRRHRREPRPPRAFCLLLRAVA
GPVPSPLALRRLGFGWPGGGGSAAEERAVLVVSSR
TQRKESLFREIRAQARALGAALASEPLP
Isotype
IgG
Antibody clone number
2G12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -