HPA034729

LDAH antibody from MilliporeSigma / Merck KGaA
C2orf43, FLJ21820
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA034729
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA034729, RRID:AB_10603684
Product name
Anti-C2orf43 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA034729
Antibody type
Polyclonal
Antigen
UPF0554 protein C2orf43 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PETIKSLLIRRGLQVMNLENEFSPLNILEPFCLAN
AAYLGGQEMMEVVKRDDETIKEHLCKLTFYYGTID
PWCPKEYYEDIKKDFPE
Storage
-20C
Provider Type Product Number
- No reagents -