Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003222-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003222-M01, RRID:AB_1137259
- Product name
- HOXC5 monoclonal antibody (M01), clone 1E10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HOXC5.
- Antigen sequence
MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQA
SRYCYGGLDLSITFPPPAPSNSLHGVDMAANPR- Isotype
- IgG
- Antibody clone number
- 1E10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Homeobox family Hoxc localization during murine palate formation.
Hirata A, Katayama K, Tsuji T, Imura H, Natsume N, Sugahara T, Kunieda T, Nakamura H, Otsuki Y
Congenital anomalies 2015 Dec 31;
Congenital anomalies 2015 Dec 31;
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HOXC5 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol