Antibody data

Product number
ABIN405226
Provider
antibodies-online
Product name
anti-Homeobox C5 (HOXC5) antibody
Provider product page
antibodies-online - ABIN405226
Antibody type
Polyclonal
Antigen
The immunogen for anti-HOXC5 antibody: synthetic peptide directed towards the N terminal of human HOXC5
Reactivity
Human, Mouse, Rat, Bovine, Canine, Xenopus
Host
Rabbit
Antigen sequence
MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQA
SRYCY GGLDLSITFP
Vial size
50 µg
Provider Type Product Number
- No reagents -