Antibody data

Product number
ABIN486827
Provider
antibodies-online
Product name
anti-Homeobox C5 (HOXC5) (Middle Region) antibody
Provider product page
antibodies-online - ABIN486827
Antibody type
Polyclonal
Antigen
The immunogen for anti-HOXC5 antibody: synthetic peptide directed towards the middle region of human HOXC5
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
WMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFN
RYLTR RRRIEIANNL
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -