Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501807 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Homeobox C5 (HOXC5) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HOXC5 antibody: synthetic peptide directed towards the middle region of human HOXC5
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Zebrafish
- Host
- Rabbit
- Antigen sequence
KEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNR
RMKWK KDSKMKSKEA- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Analysis of single nucleotide polymorphisms and haplotypes in HOXC gene cluster within susceptible region 12q13 of simple congenital heart disease.
Gong LG, Qiu GR, Jiang H, Xu XY, Zhu HY, Sun KL
Zhonghua yi xue yi chuan xue za zhi = Zhonghua yixue yichuanxue zazhi = Chinese journal of medical genetics 2005 Oct;22(5):497-501
Zhonghua yi xue yi chuan xue za zhi = Zhonghua yixue yichuanxue zazhi = Chinese journal of medical genetics 2005 Oct;22(5):497-501
No comments: Submit comment
No validations: Submit validation data