HPA018215

GUCA2A antibody from Sigma-Aldrich
GUCA2, STARA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018215
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018215, RRID:AB_1850443
Product name
Anti-GUCA2A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018215
Antibody type
Polyclonal
Antigen
Guanylin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVP
ILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDP
GTCEICAYAACTGC
Storage
-20C
Provider Type Product Number
- No reagents -